SCOPe 2.06: Domain d1gama_: 1gam A:

Lineage for d1gama_ (1gam A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein gamma-Crystallin [49697] (9 species)
   duplication consists of two domains of this fold

7. Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (6 PDB entries)

8. Domain d1gama_: 1gam A: [23594]
   C-terminal domain only

Details for d1gama_

PDB Entry: 1gam, 2.6 Å

PDB Description: gamma b crystallin truncated c-terminal domain

PDB Compounds: (A:) gamma b crystallin

SCOPe Domain Sequences for d1gama_:

Sequence; same for both SEQRES and ATOM records:

>d1gama_ b.11.1.1 (A:) gamma-Crystallin {Cow (Bos taurus), isoform II (B) [TaxId: 9913]}
tfrmriyerddfrgqmseitadcpslqdrfhltevhslnvlegswvlyempsyrgrqyll
rpgeyrryldwgamnakvgslrrvmd

Timeline for d1gama_:

• d1gama_ first appeared (with stable ids) in SCOP 1.55
  
• d1gama_ appears in SCOPe 2.05
  
• d1gama_ appears in SCOPe 2.07
  
• d1gama_ appears in the current release, SCOPe 2.08