Lineage for d1gama_ (1gam A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383151Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2383152Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2383153Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2383191Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2383201Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (6 PDB entries)
  8. 2383211Domain d1gama_: 1gam A: [23594]
    C-terminal domain only

Details for d1gama_

PDB Entry: 1gam (more details), 2.6 Å

PDB Description: gamma b crystallin truncated c-terminal domain
PDB Compounds: (A:) gamma b crystallin

SCOPe Domain Sequences for d1gama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gama_ b.11.1.1 (A:) gamma-Crystallin {Cow (Bos taurus), isoform II (B) [TaxId: 9913]}
tfrmriyerddfrgqmseitadcpslqdrfhltevhslnvlegswvlyempsyrgrqyll
rpgeyrryldwgamnakvgslrrvmd

SCOPe Domain Coordinates for d1gama_:

Click to download the PDB-style file with coordinates for d1gama_.
(The format of our PDB-style files is described here.)

Timeline for d1gama_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gamb_