Class b: All beta proteins [48724] (178 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein gamma-Crystallin [49697] (9 species) duplication consists of two domains of this fold |
Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (6 PDB entries) |
Domain d1gama_: 1gam A: [23594] C-terminal domain only |
PDB Entry: 1gam (more details), 2.6 Å
SCOPe Domain Sequences for d1gama_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gama_ b.11.1.1 (A:) gamma-Crystallin {Cow (Bos taurus), isoform II (B) [TaxId: 9913]} tfrmriyerddfrgqmseitadcpslqdrfhltevhslnvlegswvlyempsyrgrqyll rpgeyrryldwgamnakvgslrrvmd
Timeline for d1gama_: