Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (1 family) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein Polyomavirus coat proteins [49657] (2 species) |
Species Simian virus 40, Sv40 [TaxId:10633] [49691] (1 PDB entry) |
Domain d1sva1_: 1sva 1: [23580] |
PDB Entry: 1sva (more details), 3.1 Å
SCOPe Domain Sequences for d1sva1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sva1_ b.121.6.1 (1:) Polyomavirus coat proteins {Simian virus 40, Sv40 [TaxId: 10633]} pkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaek qftddspdkeqlpcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtq kthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdh kavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgpl ckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpypisfllsdlinrrt qrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrmq
Timeline for d1sva1_: