Lineage for d1sva1_ (1sva 1:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11829Protein Simian virus 40 (SV40) coat protein [49690] (1 species)
  7. 11830Species Simian virus 40 [TaxId:10633] [49691] (1 PDB entry)
  8. 11831Domain d1sva1_: 1sva 1: [23580]

Details for d1sva1_

PDB Entry: 1sva (more details), 3.1 Å

PDB Description: simian virus 40

SCOP Domain Sequences for d1sva1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sva1_ b.10.1.4 (1:) Simian virus 40 (SV40) coat protein {Simian virus 40}
pkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaek
qftddspdkeqlpcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtq
kthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdh
kavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgpl
ckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpypisfllsdlinrrt
qrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrmq

SCOP Domain Coordinates for d1sva1_:

Click to download the PDB-style file with coordinates for d1sva1_.
(The format of our PDB-style files is described here.)

Timeline for d1sva1_: