SCOPe 2.08: Domain d4l0la1: 4l0l A:53-221

Lineage for d4l0la1 (4l0l A:53-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [234430] (7 PDB entries)

8. Domain d4l0la1: 4l0l A:53-221 [235253]
   Other proteins in same PDB: d4l0la2
   automated match to d4kqoa1
   complexed with pfv

Details for d4l0la1

PDB Entry: 4l0l, 2.1 Å

PDB Description: Crystal structure of P.aeruginosa PBP3 in complex with compound 4

PDB Compounds: (A:) penicillin-binding protein 3

SCOPe Domain Sequences for d4l0la1:

Sequence; same for both SEQRES and ATOM records:

>d4l0la1 d.175.1.0 (A:53-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
vrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfad
rieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvdd
rgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Timeline for d4l0la1:

• d4l0la1 first appeared in SCOPe 2.03
  
• d4l0la1 appears in SCOPe 2.07