Lineage for d4k1xb2 (4k1x B:114-266)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359066Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1359067Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1359225Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 1359226Protein automated matches [226871] (12 species)
    not a true protein
  7. 1359265Species Rhodobacter capsulatus [TaxId:1061] [225020] (7 PDB entries)
  8. 1359268Domain d4k1xb2: 4k1x B:114-266 [235078]
    Other proteins in same PDB: d4k1xa1, d4k1xb1
    automated match to d4k1xa2
    complexed with fad, so4; mutant

Details for d4k1xb2

PDB Entry: 4k1x (more details), 1.7 Å

PDB Description: Ferredoxin-NADP(H) Reductase mutant with Ala 266 replaced by Tyr (A266Y) and residues 267-272 deleted.
PDB Compounds: (B:) nadph:ferredoxin reductase

SCOPe Domain Sequences for d4k1xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1xb2 c.25.1.0 (B:114-266) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
idallpgkrlwflatgtgiapfaslmrepeayekfdevimmhacrtvaeleygrqlveal
qedpligelvegklkyyptttreefhhmgritdnlasgkvfedlgiapmnpetdramvcg
slafnvdvmkvlesyglreganseprefvveky

SCOPe Domain Coordinates for d4k1xb2:

Click to download the PDB-style file with coordinates for d4k1xb2.
(The format of our PDB-style files is described here.)

Timeline for d4k1xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k1xb1