Lineage for d4k1xb1 (4k1x B:16-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317445Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1317611Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 1317612Protein automated matches [226870] (15 species)
    not a true protein
  7. 1317682Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries)
  8. 1317685Domain d4k1xb1: 4k1x B:16-113 [235077]
    Other proteins in same PDB: d4k1xa2, d4k1xb2
    automated match to d4k1xa1
    complexed with fad, so4; mutant

Details for d4k1xb1

PDB Entry: 4k1x (more details), 1.7 Å

PDB Description: Ferredoxin-NADP(H) Reductase mutant with Ala 266 replaced by Tyr (A266Y) and residues 267-272 deleted.
PDB Compounds: (B:) nadph:ferredoxin reductase

SCOPe Domain Sequences for d4k1xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1xb1 b.43.4.0 (B:16-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspawde
elefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv

SCOPe Domain Coordinates for d4k1xb1:

Click to download the PDB-style file with coordinates for d4k1xb1.
(The format of our PDB-style files is described here.)

Timeline for d4k1xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k1xb2