SCOPe 2.06: Domain d4i6ta_: 4i6t A:

Lineage for d4i6ta_ (4i6t A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (10 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d4i6ta_: 4i6t A: [234820]
   automated match to d4i6tb_
   complexed with mli; mutant

Details for d4i6ta_

PDB Entry: 4i6t, 2 Å

PDB Description: Crystal Structure of a T36A mutant of the Restriction-Modification Controller Protein C.Esp1396I

PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d4i6ta_:

Sequence; same for both SEQRES and ATOM records:

>d4i6ta_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrayisgiernsrnltikslelimkglev
sdvvffemlikeilk

Timeline for d4i6ta_:

• d4i6ta_ first appeared in SCOPe 2.03
  
• d4i6ta_ appears in SCOPe 2.05
  
• d4i6ta_ appears in SCOPe 2.07
  
• d4i6ta_ appears in the current release, SCOPe 2.08