SCOPe 2.06: Domain d1piv3_: 1piv 3:

Lineage for d1piv3_ (1piv 3:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Poliovirus coat proteins [49666] (3 species)

7. Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries)

8. Domain d1piv3_: 1piv 3: [23437]
   complexed with myr, w71

Details for d1piv3_

PDB Entry: 1piv, 2.9 Å

PDB Description: binding of the antiviral drug win51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14

PDB Compounds: (3:) poliovirus type 3 (subunit vp3)

SCOPe Domain Sequences for d1piv3_:

Sequence; same for both SEQRES and ATOM records:

>d1piv3_ b.121.4.1 (3:) Poliovirus coat proteins {Poliovirus type 3, strain Sabin [TaxId: 12086]}
glpvlntpgsnqyltsdnhqspcaipefdvtppidipgevknmmelaeidtmiplnlest
krntmdmyrvtlsdsadlsqpilclslspafdprlshtmlgevlnyythwagslkftflf
cgsmmatgkilvayappgaqpptsrkeamlgthviwdlglqssctmvvpwisnvtyrqtt
qdsfteggyismfyqtrivvplstpksmsmlgfvsacndfsvrllrdtthisqsa

Timeline for d1piv3_:

• d1piv3_ first appeared (with stable ids) in SCOP 1.55
  
• d1piv3_ appears in SCOPe 2.05
  
• d1piv3_ appears in SCOPe 2.07
  
• d1piv3_ appears in the current release, SCOPe 2.08