SCOPe 2.06: Domain d3taqa2: 3taq A:469-876

Lineage for d3taqa2 (3taq A:469-876)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)

6. Protein automated matches [226972] (9 species)
   not a true protein

7. Species Geobacillus sp. [TaxId:129337] [233671] (4 PDB entries)

8. Domain d3taqa2: 3taq A:469-876 [233676]
   Other proteins in same PDB: d3taqa1
   automated match to d2hhva2
   protein/DNA complex; complexed with mg, so4, suc

Details for d3taqa2

PDB Entry: 3taq, 1.65 Å

PDB Description: crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-4) position

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3taqa2:

Sequence; same for both SEQRES and ATOM records:

>d3taqa2 e.8.1.1 (A:469-876) automated matches {Geobacillus sp. [TaxId: 129337]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

Timeline for d3taqa2:

• d3taqa2 first appeared in SCOPe 2.03
  
• d3taqa2 appears in SCOPe 2.05
  
• d3taqa2 appears in SCOPe 2.07
  
• d3taqa2 appears in the current release, SCOPe 2.08