Lineage for d2hhva2 (2hhv A:469-876)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2246834Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2246835Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 2246836Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (44 PDB entries)
    Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
    Uniprot Q45458 298-876 # 88% sequence identity
  8. 2246837Domain d2hhva2: 2hhv A:469-876 [136515]
    Other proteins in same PDB: d2hhva1
    automatically matched to d1l3sa2
    protein/DNA complex; complexed with mg, so4, suc

Details for d2hhva2

PDB Entry: 2hhv (more details), 1.55 Å

PDB Description: t:o6-methyl-guanine in the polymerase-2 basepair position
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d2hhva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhva2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOPe Domain Coordinates for d2hhva2:

Click to download the PDB-style file with coordinates for d2hhva2.
(The format of our PDB-style files is described here.)

Timeline for d2hhva2:

2246837
d2hhva2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2hhva1