SCOPe 2.06: Domain d1ddlb_: 1ddl B:

Lineage for d1ddlb_ (1ddl B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins)
   automatically mapped to Pfam PF00983

6. Protein Tymovirus coat protein [88642] (3 species)

7. Species DYMV (Desmodium yellow mottle tymovirus) [TaxId:70821] [49644] (1 PDB entry)

8. Domain d1ddlb_: 1ddl B: [23318]
   protein/RNA complex

Details for d1ddlb_

PDB Entry: 1ddl, 2.7 Å

PDB Description: desmodium yellow mottle tymovirus

PDB Compounds: (B:) desmodium yellow mottle virus

SCOPe Domain Sequences for d1ddlb_:

Sequence; same for both SEQRES and ATOM records:

>d1ddlb_ b.121.4.6 (B:) Tymovirus coat protein {DYMV (Desmodium yellow mottle tymovirus) [TaxId: 70821]}
meqdkilahqaslntkpsllpppvgnpppvisypfqitlaslgtedaadsvsiasnsvla
tytalyrhaqlkhlkatihptymapkyptsvalvwvpanstatstqvldtygglhfcigg
svnsvkpidveanltnlnpiikasttftdtpkllyyskaqataptsptcyltiqgqiels
spllqass

Timeline for d1ddlb_:

• d1ddlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ddlb_ appears in SCOPe 2.05
  
• d1ddlb_ appears in SCOPe 2.07
  
• d1ddlb_ appears in the current release, SCOPe 2.08