Lineage for d1stmb_ (1stm B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823761Superfamily b.121.7: Satellite viruses [88650] (1 family) (S)
  5. 2823762Family b.121.7.1: Satellite viruses [88651] (3 proteins)
  6. 2823763Protein SPMV coat protein [49617] (1 species)
  7. 2823764Species Satellite panicum mosaic virus [TaxId:154834] [49618] (1 PDB entry)
  8. 2823766Domain d1stmb_: 1stm B: [23282]

Details for d1stmb_

PDB Entry: 1stm (more details), 1.9 Å

PDB Description: satellite panicum mosaic virus
PDB Compounds: (B:) satellite panicum mosaic virus

SCOPe Domain Sequences for d1stmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1stmb_ b.121.7.1 (B:) SPMV coat protein {Satellite panicum mosaic virus [TaxId: 154834]}
aaatslvydtcyvtlterattsfqrqsfptlkgmgdrafqvvaftiqgvsaaplmynarl
ynpgdtdsvhatgvqlmgtvprtvrltprvgqnnwffgnteeaetilaidglvstkgana
psntvivtgcfrlapselqss

SCOPe Domain Coordinates for d1stmb_:

Click to download the PDB-style file with coordinates for d1stmb_.
(The format of our PDB-style files is described here.)

Timeline for d1stmb_: