SCOPe 2.02: Domain d1bf8a2: 1bf8 A:122-205

Lineage for d1bf8a2 (1bf8 A:122-205)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein FimC [49588] (1 species)

7. Species Escherichia coli [TaxId:562] [49589] (6 PDB entries)

8. Domain d1bf8a2: 1bf8 A:122-205 [23214]
   Other proteins in same PDB: d1bf8a1

Details for d1bf8a2

PDB Entry: 1bf8

PDB Description: periplasmic chaperone fimc, nmr, 20 structures

PDB Compounds: (A:) chaperone protein fimc

SCOPe Domain Sequences for d1bf8a2:

Sequence; same for both SEQRES and ATOM records:

>d1bf8a2 b.7.2.1 (A:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

Timeline for d1bf8a2:

• d1bf8a2 first appeared (with stable ids) in SCOP 1.55, called d1bf8_2
  
• d1bf8a2 appears in SCOPe 2.01
  
• d1bf8a2 appears in SCOPe 2.03
  
• d1bf8a2 appears in the current release, SCOPe 2.08