Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (2 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (5 proteins) |
Protein Periplasmic chaperone FimC [49358] (1 species) |
Species Escherichia coli [TaxId:562] [49359] (6 PDB entries) |
Domain d1bf8a1: 1bf8 A:1-121 [22332] Other proteins in same PDB: d1bf8a2 |
PDB Entry: 1bf8 (more details)
SCOPe Domain Sequences for d1bf8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf8a1 b.1.11.1 (A:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl a
Timeline for d1bf8a1: