Lineage for d1bf8a1 (1bf8 A:1-121)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111327Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 1111328Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 1111340Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 1111341Species Escherichia coli [TaxId:562] [49359] (6 PDB entries)
  8. 1111368Domain d1bf8a1: 1bf8 A:1-121 [22332]
    Other proteins in same PDB: d1bf8a2

Details for d1bf8a1

PDB Entry: 1bf8 (more details)

PDB Description: periplasmic chaperone fimc, nmr, 20 structures
PDB Compounds: (A:) chaperone protein fimc

SCOPe Domain Sequences for d1bf8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf8a1 b.1.11.1 (A:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOPe Domain Coordinates for d1bf8a1:

Click to download the PDB-style file with coordinates for d1bf8a1.
(The format of our PDB-style files is described here.)

Timeline for d1bf8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bf8a2