Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) |
Family d.118.1.0: automated matches [191348] (1 protein) not a true family |
Protein automated matches [190280] (10 species) not a true protein |
Species Alvinella pompejana [TaxId:6376] [232063] (1 PDB entry) |
Domain d3ep1a_: 3ep1 A: [232064] automated match to d2rkqa_ |
PDB Entry: 3ep1 (more details), 2.1 Å
SCOPe Domain Sequences for d3ep1a_:
Sequence, based on SEQRES records: (download)
>d3ep1a_ d.118.1.0 (A:) automated matches {Alvinella pompejana [TaxId: 6376]} ladsivprqqwaaieprrqikmngradeiflwqtgpdtcslmgltadkcqgclqdsscte qivkalqdadfkegnddikynflidqdgviyegrgwgvvgqhtkgrdshsigvavigdfg kkepsqalqdalskliicgqaaeelssgarlrttpamsgqafydmldrcdglcl
>d3ep1a_ d.118.1.0 (A:) automated matches {Alvinella pompejana [TaxId: 6376]} ladsivprqqwaaieprrqikmngradeiflwqtgpdtcslmggclqdsscteqivkalq dadfkegnddikynflidqdgviyegrgwgvvgqhtkgrdshsigvavigdfgkkepsqa lqdalskliicgqaaeelssgarlrttpamsgqafydmldrcdglcl
Timeline for d3ep1a_: