Lineage for d2rkqa_ (2rkq A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924236Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1924237Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1924438Family d.118.1.0: automated matches [191348] (1 protein)
    not a true family
  6. 1924439Protein automated matches [190280] (4 species)
    not a true protein
  7. 1924450Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187079] (3 PDB entries)
  8. 1924451Domain d2rkqa_: 2rkq A: [168169]
    automated match to d2f2lx1

Details for d2rkqa_

PDB Entry: 2rkq (more details), 1.5 Å

PDB Description: Crystal structure of drosophila peptidoglycan recognition protein SD (PGRP-SD)
PDB Compounds: (A:) Peptidoglycan-recognition protein-SD

SCOPe Domain Sequences for d2rkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rkqa_ d.118.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
evpivtraewnakppngaidsmvtplpraviahtaggacaddvtcsqhmrnlqnfqmskq
kfsdigyhyliggngkvyegrspsqrgafagpnndgslgiafignfeerapnkealdaak
elleqavkqaqlvegykllghrqvsatkspgealyaliqqwpnwseeml

SCOPe Domain Coordinates for d2rkqa_:

Click to download the PDB-style file with coordinates for d2rkqa_.
(The format of our PDB-style files is described here.)

Timeline for d2rkqa_: