SCOPe 2.06: Domain d2rkqa1: 2rkq A:11-177

Lineage for d2rkqa1 (2rkq A:11-177)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.0: automated matches [191348] (1 protein)
   not a true family

6. Protein automated matches [190280] (4 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187079] (3 PDB entries)

8. Domain d2rkqa1: 2rkq A:11-177 [168169]
   Other proteins in same PDB: d2rkqa2
   automated match to d2f2lx1

Details for d2rkqa1

PDB Entry: 2rkq, 1.5 Å

PDB Description: Crystal structure of drosophila peptidoglycan recognition protein SD (PGRP-SD)

PDB Compounds: (A:) Peptidoglycan-recognition protein-SD

SCOPe Domain Sequences for d2rkqa1:

Sequence; same for both SEQRES and ATOM records:

>d2rkqa1 d.118.1.0 (A:11-177) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
evpivtraewnakppngaidsmvtplpraviahtaggacaddvtcsqhmrnlqnfqmskq
kfsdigyhyliggngkvyegrspsqrgafagpnndgslgiafignfeerapnkealdaak
elleqavkqaqlvegykllghrqvsatkspgealyaliqqwpnwseem

Timeline for d2rkqa1:

• d2rkqa1 first appeared in SCOPe 2.01, called d2rkqa_
  
• d2rkqa1 was called d2rkqa_ in SCOPe 2.05
  
• d2rkqa1 appears in SCOPe 2.07
  
• d2rkqa1 appears in the current release, SCOPe 2.08