Lineage for d2ymef_ (2yme F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811015Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)
  8. 1811111Domain d2ymef_: 2yme F: [231631]
    automated match to d2qc1b_
    complexed with cwb, na, nag, po4; mutant

Details for d2ymef_

PDB Entry: 2yme (more details), 2.4 Å

PDB Description: crystal structure of a mutant binding protein (5htbp-achbp) in complex with granisetron
PDB Compounds: (F:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2ymef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymef_ b.96.1.0 (F:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2ymef_:

Click to download the PDB-style file with coordinates for d2ymef_.
(The format of our PDB-style files is described here.)

Timeline for d2ymef_: