Lineage for d2bt2c_ (2bt2 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741165Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1741166Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1741227Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 1741228Protein automated matches [190464] (2 species)
    not a true protein
  7. 1741232Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)
  8. 1741238Domain d2bt2c_: 2bt2 C: [230546]
    automated match to d2af0a_

Details for d2bt2c_

PDB Entry: 2bt2 (more details), 1.9 Å

PDB Description: structure of the regulator of g-protein signaling 16
PDB Compounds: (C:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d2bt2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bt2c_ a.91.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkki
rsatklasrahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlme
kdsyprflkspayrdlaaqasa

SCOPe Domain Coordinates for d2bt2c_:

Click to download the PDB-style file with coordinates for d2bt2c_.
(The format of our PDB-style files is described here.)

Timeline for d2bt2c_: