SCOPe 2.08: Domain d2bt2c1: 2bt2 C:53-186

Lineage for d2bt2c1 (2bt2 C:53-186)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d2bt2c1: 2bt2 C:53-186 [230546]
   Other proteins in same PDB: d2bt2a2, d2bt2b2, d2bt2c2, d2bt2d2, d2bt2e2
   automated match to d2af0a_

Details for d2bt2c1

PDB Entry: 2bt2, 1.9 Å

PDB Description: structure of the regulator of g-protein signaling 16

PDB Compounds: (C:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d2bt2c1:

Sequence; same for both SEQRES and ATOM records:

>d2bt2c1 a.91.1.0 (C:53-186) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkirsatklas
rahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmekdsyprfl
kspayrdlaaqasa

Timeline for d2bt2c1:

• d2bt2c1 first appeared in SCOPe 2.03, called d2bt2c_
  
• d2bt2c1 appears in SCOPe 2.07