![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Azurin [49530] (6 species) |
![]() | Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (4 PDB entries) |
![]() | Domain d1rkrb_: 1rkr B: [22920] complexed with cu |
PDB Entry: 1rkr (more details), 2.45 Å
SCOPe Domain Sequences for d1rkrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkrb_ b.6.1.1 (B:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal mkgvlklvd
Timeline for d1rkrb_: