SCOPe 2.08: Domain d4l74a2: 4l74 A:245-336

Lineage for d4l74a2 (4l74 A:245-336)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families)

5. Family d.286.1.0: automated matches [228502] (1 protein)
   not a true family

6. Protein automated matches [228504] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)

8. Domain d4l74a2: 4l74 A:245-336 [228510]
   Other proteins in same PDB: d4l74a1, d4l74a3, d4l74b1, d4l74b3
   automated match to d2fy8a2
   complexed with ca

Details for d4l74a2

PDB Entry: 4l74, 1.84 Å

PDB Description: ca2+-bound mthk rck domain at 1.9 angstrom with single ligand

PDB Compounds: (A:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4l74a2:

Sequence; same for both SEQRES and ATOM records:

>d4l74a2 d.286.1.0 (A:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

Timeline for d4l74a2:

• d4l74a2 first appeared in SCOPe 2.03
  
• d4l74a2 appears in SCOPe 2.07