Lineage for d4l74a2 (4l74 A:245-339)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1448316Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 1448317Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 1448348Family d.286.1.0: automated matches [228502] (1 protein)
    not a true family
  6. 1448349Protein automated matches [228504] (1 species)
    not a true protein
  7. 1448350Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (6 PDB entries)
  8. 1448351Domain d4l74a2: 4l74 A:245-339 [228510]
    Other proteins in same PDB: d4l74a1, d4l74b1
    automated match to d2fy8a2
    complexed with ca

Details for d4l74a2

PDB Entry: 4l74 (more details), 1.84 Å

PDB Description: ca2+-bound mthk rck domain at 1.9 angstrom with single ligand
PDB Compounds: (A:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4l74a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l74a2 d.286.1.0 (A:245-339) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisalvp

SCOPe Domain Coordinates for d4l74a2:

Click to download the PDB-style file with coordinates for d4l74a2.
(The format of our PDB-style files is described here.)

Timeline for d4l74a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l74a1