Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
Domain d4bw3a1: 4bw3 A:44-168 [227835] Other proteins in same PDB: d4bw3a2 automated match to d3p5oa_ complexed with 9bm, edo |
PDB Entry: 4bw3 (more details), 1.5 Å
SCOPe Domain Sequences for d4bw3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bw3a1 a.29.2.0 (A:44-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} nppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiikt pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine lptee
Timeline for d4bw3a1: