Lineage for d4ikaa_ (4ika A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2247714Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2248029Protein automated matches [190260] (29 species)
    not a true protein
  7. 2248257Species Human enterovirus 71 [TaxId:39054] [189988] (4 PDB entries)
  8. 2248260Domain d4ikaa_: 4ika A: [227711]
    automated match to d3ol9a_
    complexed with ni

Details for d4ikaa_

PDB Entry: 4ika (more details), 2.7 Å

PDB Description: Crystal structure of EV71 3Dpol-VPg
PDB Compounds: (A:) 3Dpol

SCOPe Domain Sequences for d4ikaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ikaa_ e.8.1.4 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
geiqwvkpnketgrlsingptrtklepsvfhdvfegnkepavlhskdprlevdfeqalfs
kyvgntlyepdeyikeaalhyanqlkqleintsqmsmeeacygtenleaidlhtsagypy
salgikkrdildpttrdvskmkfymdkygldlpystyvkdelrsidkikkgksrlieass
lndsvylrmafghlyetfhanpgtitgsavgcnpdtfwsklpillpgslfafdysgydas
lspvwfralelvlreigyseeaislieginhthhvyrnktycvlggmpsgcsgtsifnsm
inniiiralliktfkgidldelnmvaygddvlasypfpidclelaktgkeygltmtpadk
spcfnevnwdnatflkrgflpdeqfpflihptmpmreihesirwtkdarntqdhvrslcl
lawhngkqeyekfvstirsvpvgralaipnyenlrrnwlelf

SCOPe Domain Coordinates for d4ikaa_:

Click to download the PDB-style file with coordinates for d4ikaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ikaa_: