Lineage for d4jzdl_ (4jzd L:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2635903Protein Coagulation factor VIIa [57201] (1 species)
  7. 2635904Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2635998Domain d4jzdl_: 4jzd L: [227605]
    Other proteins in same PDB: d4jzdh_
    automated match to d1w7xl_
    complexed with 1nj, ca, gol, so4

Details for d4jzdl_

PDB Entry: 4jzd (more details), 2.2 Å

PDB Description: structure of factor viia in complex with the inhibitor 2-{2-[(4- carbamimidoylphenyl)carbamoyl]-6-methoxypyridin-3-yl}-5-{[(2s)-1- hydroxy-3,3-dimethylbutan-2-yl]carbamoyl}benzoic acid
PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d4jzdl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jzdl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOPe Domain Coordinates for d4jzdl_:

Click to download the PDB-style file with coordinates for d4jzdl_.
(The format of our PDB-style files is described here.)

Timeline for d4jzdl_: