SCOPe 2.06: Domain d4jzdl_: 4jzd L:

Lineage for d4jzdl_ (4jzd L:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d4jzdl_: 4jzd L: [227605]
   Other proteins in same PDB: d4jzdh_
   automated match to d1w7xl_
   complexed with 1nj, ca, gol, so4

Details for d4jzdl_

PDB Entry: 4jzd, 2.2 Å

PDB Description: structure of factor viia in complex with the inhibitor 2-{2-[(4- carbamimidoylphenyl)carbamoyl]-6-methoxypyridin-3-yl}-5-{[(2s)-1- hydroxy-3,3-dimethylbutan-2-yl]carbamoyl}benzoic acid

PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d4jzdl_:

Sequence; same for both SEQRES and ATOM records:

>d4jzdl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d4jzdl_:

• d4jzdl_ first appeared in SCOPe 2.03
  
• d4jzdl_ appears in SCOPe 2.05
  
• d4jzdl_ appears in SCOPe 2.07
  
• d4jzdl_ appears in the current release, SCOPe 2.08