Lineage for d1qhpa2 (1qhp A:577-686)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162042Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 162043Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 162044Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 162054Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 162097Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49457] (2 PDB entries)
  8. 162099Domain d1qhpa2: 1qhp A:577-686 [22514]
    Other proteins in same PDB: d1qhpa1, d1qhpa3, d1qhpa4

Details for d1qhpa2

PDB Entry: 1qhp (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex

SCOP Domain Sequences for d1qhpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhpa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase}
lsgtqtsvvftvksapptnlgdkiyltgnipelgnwstdtsgavnnaqgpllapnypdwf
yvfsvpagktiqfkffikradgtiqwengsnhvattptgatgnitvtwqn

SCOP Domain Coordinates for d1qhpa2:

Click to download the PDB-style file with coordinates for d1qhpa2.
(The format of our PDB-style files is described here.)

Timeline for d1qhpa2: