Lineage for d1qhpa2 (1qhp A:577-686)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768632Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2768693Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49457] (2 PDB entries)
  8. 2768694Domain d1qhpa2: 1qhp A:577-686 [22514]
    Other proteins in same PDB: d1qhpa1, d1qhpa3, d1qhpa4
    complexed with ca, so4

Details for d1qhpa2

PDB Entry: 1qhp (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1qhpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhpa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}
lsgtqtsvvftvksapptnlgdkiyltgnipelgnwstdtsgavnnaqgpllapnypdwf
yvfsvpagktiqfkffikradgtiqwengsnhvattptgatgnitvtwqn

SCOPe Domain Coordinates for d1qhpa2:

Click to download the PDB-style file with coordinates for d1qhpa2.
(The format of our PDB-style files is described here.)

Timeline for d1qhpa2: