SCOPe 2.06: Domain d1cgta2: 1cgt A:580-684

Lineage for d1cgta2 (1cgt A:580-684)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d1cgta2: 1cgt A:580-684 [22484]
   Other proteins in same PDB: d1cgta1, d1cgta3, d1cgta4
   complexed with ca

Details for d1cgta2

PDB Entry: 1cgt, 2 Å

PDB Description: structure of cyclodextrin glycosyltransferase refined at 2.0 angstroms resolution

PDB Compounds: (A:) cyclodextrin glycosyl-transferase

SCOPe Domain Sequences for d1cgta2:

Sequence; same for both SEQRES and ATOM records:

>d1cgta2 b.3.1.1 (A:580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

Timeline for d1cgta2:

• d1cgta2 first appeared (with stable ids) in SCOP 1.55, called d1cgt_2
  
• d1cgta2 appears in SCOPe 2.05
  
• d1cgta2 appears in SCOPe 2.07
  
• d1cgta2 appears in the current release, SCOPe 2.08