Lineage for d1cgta2 (1cgt A:580-684)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378394Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2378395Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2378428Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2378429Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 2378436Domain d1cgta2: 1cgt A:580-684 [22484]
    Other proteins in same PDB: d1cgta1, d1cgta3, d1cgta4
    complexed with ca

Details for d1cgta2

PDB Entry: 1cgt (more details), 2 Å

PDB Description: structure of cyclodextrin glycosyltransferase refined at 2.0 angstroms resolution
PDB Compounds: (A:) cyclodextrin glycosyl-transferase

SCOPe Domain Sequences for d1cgta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgta2 b.3.1.1 (A:580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

SCOPe Domain Coordinates for d1cgta2:

Click to download the PDB-style file with coordinates for d1cgta2.
(The format of our PDB-style files is described here.)

Timeline for d1cgta2: