SCOPe 2.08: Domain d1vkxb2: 1vkx B:339-546

Lineage for d1vkxb2 (1vkx B:339-546)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49425] (7 PDB entries)

8. Domain d1vkxb2: 1vkx B:339-546 [22446]
   Other proteins in same PDB: d1vkxa1, d1vkxa2, d1vkxb1
   protein/DNA complex

Details for d1vkxb2

PDB Entry: 1vkx, 2.9 Å

PDB Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna

PDB Compounds: (B:) protein (nf-kappa b p50 subunit)

SCOPe Domain Sequences for d1vkxb2:

Sequence; same for both SEQRES and ATOM records:

>d1vkxb2 b.2.5.3 (B:339-546) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnas

Timeline for d1vkxb2:

• d1vkxb2 first appeared (with stable ids) in SCOP 1.55
  
• d1vkxb2 appears in SCOPe 2.07