Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (2 families) |
Family c.65.1.0: automated matches [191608] (1 protein) not a true family |
Protein automated matches [191110] (11 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226570] (2 PDB entries) |
Domain d4iqfc1: 4iqf C:1-204 [223316] Other proteins in same PDB: d4iqfa2, d4iqfa3, d4iqfb2, d4iqfb3, d4iqfc2, d4iqfc3, d4iqfd2, d4iqfd3 automated match to d1fmta2 complexed with gol, pg5, so4 |
PDB Entry: 4iqf (more details), 2.38 Å
SCOPe Domain Sequences for d4iqfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iqfc1 c.65.1.0 (C:1-204) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhgipv lqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrggap ihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahllskt vplliqgklepikqneeevtfayn
Timeline for d4iqfc1: