SCOP 1.65: Domain d1eqwc_: 1eqw C:

Lineage for d1eqwc_ (1eqw C:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Salmonella typhimurium [TaxId:90371] [49339] (1 PDB entry)

8. Domain d1eqwc_: 1eqw C: [22296]

Details for d1eqwc_

PDB Entry: 1eqw, 2.3 Å

PDB Description: crystal structure of salmonella typhimurium cu,zn superoxide dismutase

SCOP Domain Sequences for d1eqwc_:

Sequence; same for both SEQRES and ATOM records:

>d1eqwc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium}
ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
lkghslmihkggdnysdkpaplggggarfacgvi

Timeline for d1eqwc_:

• d1eqwc_ first appeared (with stable ids) in SCOP 1.55
  
• d1eqwc_ appears in SCOP 1.63
  
• d1eqwc_ appears in SCOP 1.67
  
• d1eqwc_ appears in the current release, SCOPe 2.08