Lineage for d1eqwc_ (1eqw C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10106Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 10107Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 10118Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 10205Species Salmonella typhimurium [TaxId:90371] [49339] (1 PDB entry)
  8. 10208Domain d1eqwc_: 1eqw C: [22296]

Details for d1eqwc_

PDB Entry: 1eqw (more details), 2.3 Å

PDB Description: crystal structure of salmonella typhimurium cu,zn superoxide dismutase

SCOP Domain Sequences for d1eqwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqwc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium}
ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
lkghslmihkggdnysdkpaplggggarfacgvi

SCOP Domain Coordinates for d1eqwc_:

Click to download the PDB-style file with coordinates for d1eqwc_.
(The format of our PDB-style files is described here.)

Timeline for d1eqwc_: