Lineage for d4hhyb1 (4hhy B:2-135)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735148Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 1735149Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 1735174Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 1735175Protein automated matches [226964] (1 species)
    not a true protein
  7. 1735176Species Human (Homo sapiens) [TaxId:9606] [225405] (32 PDB entries)
  8. 1735203Domain d4hhyb1: 4hhy B:2-135 [222604]
    Other proteins in same PDB: d4hhya2, d4hhyb2, d4hhyc2, d4hhyd2
    automated match to d1gs0a1
    complexed with 15r, peg, so4

Details for d4hhyb1

PDB Entry: 4hhy (more details), 2.36 Å

PDB Description: Crystal structure of PARP catalytic domain in complex with novel inhibitors
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4hhyb1:

Sequence, based on SEQRES records: (download)

>d4hhyb1 a.41.1.0 (B:2-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq
gssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggs
ddsskdpidvnyek

Sequence, based on observed residues (ATOM records): (download)

>d4hhyb1 a.41.1.0 (B:2-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq
gssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrdpi
dvnyek

SCOPe Domain Coordinates for d4hhyb1:

Click to download the PDB-style file with coordinates for d4hhyb1.
(The format of our PDB-style files is described here.)

Timeline for d4hhyb1: