Class a: All alpha proteins [46456] (290 folds) |
Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
Protein automated matches [226964] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries) |
Domain d4hhyb1: 4hhy B:2-135 [222604] Other proteins in same PDB: d4hhya2, d4hhyb2, d4hhyc2, d4hhyd2 automated match to d1gs0a1 complexed with 15r, peg, so4 |
PDB Entry: 4hhy (more details), 2.36 Å
SCOPe Domain Sequences for d4hhyb1:
Sequence, based on SEQRES records: (download)
>d4hhyb1 a.41.1.0 (B:2-135) automated matches {Human (Homo sapiens) [TaxId: 9606]} sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq gssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggs ddsskdpidvnyek
>d4hhyb1 a.41.1.0 (B:2-135) automated matches {Human (Homo sapiens) [TaxId: 9606]} sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq gssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrdpi dvnyek
Timeline for d4hhyb1: