SCOPe 2.04: Domain d4fqqa1: 4fqq A:3-108

Lineage for d4fqqa1 (4fqq A:3-108)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (19 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
Domain d4fqqa1: 4fqq A:3-108 [221456]
Other proteins in same PDB: d4fqqa2, d4fqqc2, d4fqqe2, d4fqql2
automated match to d1adql1
complexed with na

Details for d4fqqa1

PDB Entry: 4fqq (more details), 2.42 Å

PDB Description: crystal structure of germline antibody pgt121-gl fab

PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d4fqqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqqa1 b.1.1.1 (A:3-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperf
sgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlg

SCOPe Domain Coordinates for d4fqqa1:

Click to download the PDB-style file with coordinates for d4fqqa1.
(The format of our PDB-style files is described here.)

Timeline for d4fqqa1: