PDB entry 4fqq

View 4fqq on RCSB PDB site
Description: Crystal Structure of Germline Antibody PGT121-GL Fab
Class: immune system
Keywords: ig fold, anti hiv, antibody, immune system
Deposited on 2012-06-25, released 2012-11-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQQ
    Domains in SCOPe 2.04: d4fqqa1, d4fqqa2
  • Chain 'B':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQQ (0-End)
  • Chain 'C':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQQ
    Domains in SCOPe 2.04: d4fqqc1, d4fqqc2
  • Chain 'D':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQQ (0-End)
  • Chain 'E':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQQ
    Domains in SCOPe 2.04: d4fqqe1, d4fqqe2
  • Chain 'F':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQQ (0-End)
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQQ (0-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQQ
    Domains in SCOPe 2.04: d4fqql1, d4fqql2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fqqA (A:)
    syvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqqA (A:)
    yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fqqC (C:)
    syvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqqC (C:)
    yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4fqqE (E:)
    syvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqqE (E:)
    yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadssvetttpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvap
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fqqL (L:)
    syvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqqL (L:)
    yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptec