Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (7 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries) |
Domain d4fp8b_: 4fp8 B: [221422] Other proteins in same PDB: d4fp8l1, d4fp8l2, d4fp8m1, d4fp8m2, d4fp8n1, d4fp8n2, d4fp8o1, d4fp8o2 automated match to d2visc_ complexed with nag, zn |
PDB Entry: 4fp8 (more details), 2.95 Å
SCOPe Domain Sequences for d4fp8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fp8b_ b.19.1.2 (B:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv pdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstyp vlnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci tpngsipndkpfqnvnkitygacpkyv
Timeline for d4fp8b_: