SCOPe 2.05: Domain d4fp8n1: 4fp8 N:1-106

Lineage for d4fp8n1 (4fp8 N:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4fp8n1: 4fp8 N:1-106 [221429]
   Other proteins in same PDB: d4fp8a_, d4fp8b_, d4fp8c_, d4fp8d_, d4fp8l2, d4fp8m2, d4fp8n2, d4fp8o2
   automated match to d1dn0a1
   complexed with nag, zn

Details for d4fp8n1

PDB Entry: 4fp8, 2.95 Å

PDB Description: crystal structure of broadly neutralizing antibody c05 bound to h3 influenza hemagglutinin, ha1 subunit

PDB Compounds: (N:) Antibody C05, Light Chain

SCOPe Domain Sequences for d4fp8n1:

Sequence; same for both SEQRES and ATOM records:

>d4fp8n1 b.1.1.0 (N:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvi

Timeline for d4fp8n1:

• d4fp8n1 first appeared in SCOPe 2.03
  
• d4fp8n1 appears in SCOPe 2.04
  
• d4fp8n1 appears in SCOPe 2.06
  
• d4fp8n1 appears in the current release, SCOPe 2.08