![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (2 families) ![]() duplication: one domain of this fold is inserted into another domain of the same fold |
![]() | Family b.2.7.0: automated matches [195107] (1 protein) not a true family |
![]() | Protein automated matches [195108] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [195109] (2 PDB entries) |
![]() | Domain d4emzm_: 4emz M: [220673] automated match to d4en2m_ |
PDB Entry: 4emz (more details), 2.9 Å
SCOPe Domain Sequences for d4emzm_:
Sequence, based on SEQRES records: (download)
>d4emzm_ b.2.7.0 (M:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} wrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndkv lfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpliw iesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpen seivwsvksfpggkeylmrahfglpsveaedkegkppisvkfeipyfttsgiqvrylkii eksgyqalpwvryitqngdyqlrtq
>d4emzm_ b.2.7.0 (M:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} wrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndkv lfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpliw iesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpen seivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvrylkiieksgyqalpw vryitqngdyqlrtq
Timeline for d4emzm_: