Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224956] (42 PDB entries) |
Domain d4edyb2: 4edy B:76-199 [220425] Other proteins in same PDB: d4edya1, d4edyb1, d4edyb3 automated match to d1pd211 complexed with 9pq, dms, gsh, mg |
PDB Entry: 4edy (more details), 1.72 Å
SCOPe Domain Sequences for d4edyb2:
Sequence, based on SEQRES records: (download)
>d4edyb2 a.45.1.1 (B:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
>d4edyb2 a.45.1.1 (B:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmscfpwaeqdvkeqmfnelltynaphlmqdldtylgg rewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrpqt kl
Timeline for d4edyb2: