SCOPe 2.06: Domain d4edya2: 4edy A:76-199

Lineage for d4edya2 (4edy A:76-199)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (42 PDB entries)

8. Domain d4edya2: 4edy A:76-199 [220423]
   Other proteins in same PDB: d4edya1, d4edyb1, d4edyb3
   automated match to d1pd211
   complexed with 9pq, dms, gsh, mg

Details for d4edya2

PDB Entry: 4edy, 1.72 Å

PDB Description: Crystal structure of hH-PGDS with water displacing inhibitor

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4edya2:

Sequence; same for both SEQRES and ATOM records:

>d4edya2 a.45.1.1 (A:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d4edya2:

• d4edya2 first appeared in SCOPe 2.03
  
• d4edya2 appears in SCOPe 2.05
  
• d4edya2 appears in SCOPe 2.07
  
• d4edya2 appears in the current release, SCOPe 2.08