Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries) |
Domain d1cd9b1: 1cd9 B:1-107 [22041] Other proteins in same PDB: d1cd9a_, d1cd9c_ complexed with nag |
PDB Entry: 1cd9 (more details), 2.8 Å
SCOPe Domain Sequences for d1cd9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvv
Timeline for d1cd9b1:
View in 3D Domains from other chains: (mouse over for more information) d1cd9a_, d1cd9c_, d1cd9d1, d1cd9d2 |