Lineage for d1cd9c_ (1cd9 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2318698Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2318705Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 2318712Species Human (Homo sapiens) [TaxId:9606] [47269] (4 PDB entries)
  8. 2318717Domain d1cd9c_: 1cd9 C: [16816]
    Other proteins in same PDB: d1cd9b1, d1cd9b2, d1cd9d1, d1cd9d2
    complexed with nag

Details for d1cd9c_

PDB Entry: 1cd9 (more details), 2.8 Å

PDB Description: 2:2 complex of g-csf with its receptor
PDB Compounds: (C:) protein (granulocyte colony-stimulating factor)

SCOPe Domain Sequences for d1cd9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd9c_ a.26.1.1 (C:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
asslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscp
sqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelg
mapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp

SCOPe Domain Coordinates for d1cd9c_:

Click to download the PDB-style file with coordinates for d1cd9c_.
(The format of our PDB-style files is described here.)

Timeline for d1cd9c_: