Lineage for d4ebql2 (4ebq L:111-214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518010Domain d4ebql2: 4ebq L:111-214 [220407]
    Other proteins in same PDB: d4ebql1
    automated match to d2fbjl2
    complexed with cl, edo, gol, po4

Details for d4ebql2

PDB Entry: 4ebq (more details), 1.6 Å

PDB Description: Fab structure of anti-Vaccinia virus D8L antigen mouse IgG2a LA5
PDB Compounds: (L:) anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, light chain

SCOPe Domain Sequences for d4ebql2:

Sequence, based on SEQRES records: (download)

>d4ebql2 b.1.1.2 (L:111-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathatstspivksfnrnec

Sequence, based on observed residues (ATOM records): (download)

>d4ebql2 b.1.1.2 (L:111-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathatspivksfnrnec

SCOPe Domain Coordinates for d4ebql2:

Click to download the PDB-style file with coordinates for d4ebql2.
(The format of our PDB-style files is described here.)

Timeline for d4ebql2: