Lineage for d1cn4a1 (1cn4 A:7-116)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767598Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 1767599Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)
  8. 1767616Domain d1cn4a1: 1cn4 A:7-116 [22027]
    Other proteins in same PDB: d1cn4c_

Details for d1cn4a1

PDB Entry: 1cn4 (more details), 2.8 Å

PDB Description: erythropoietin complexed with extracellular domains of erythropoietin receptor
PDB Compounds: (A:) protein (erythropoietin receptor)

SCOPe Domain Sequences for d1cn4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cn4a1 b.1.2.1 (A:7-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
pdpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwkl
crlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOPe Domain Coordinates for d1cn4a1:

Click to download the PDB-style file with coordinates for d1cn4a1.
(The format of our PDB-style files is described here.)

Timeline for d1cn4a1: