Class a: All alpha proteins [46456] (286 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Erythropoietin [47287] (1 species) long chain cytokine with a short-chain cytokine topology |
Species Human (Homo sapiens) [TaxId:9606] [47288] (3 PDB entries) |
Domain d1cn4c_: 1cn4 C: [16847] Other proteins in same PDB: d1cn4a1, d1cn4a2, d1cn4b1, d1cn4b2 |
PDB Entry: 1cn4 (more details), 2.8 Å
SCOPe Domain Sequences for d1cn4c_:
Sequence, based on SEQRES records: (download)
>d1cn4c_ a.26.1.2 (C:) Erythropoietin {Human (Homo sapiens) [TaxId: 9606]} pprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqav evwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeaisp pdaasaaplrtitadtfrklfrvysnflrgklklytgeacr
>d1cn4c_ a.26.1.2 (C:) Erythropoietin {Human (Homo sapiens) [TaxId: 9606]} pprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqav evwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeaisp pdrtitadtfrklfrvysnflrgklklytgeacr
Timeline for d1cn4c_:
View in 3D Domains from other chains: (mouse over for more information) d1cn4a1, d1cn4a2, d1cn4b1, d1cn4b2 |